HPA000599

DHRS1 antibody from Sigma-Aldrich
FLJ25430, MGC20204, SDR19C1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000599
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000599, RRID:AB_1078655
Product name
Anti-DHRS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000599
Antibody type
Polyclonal
Antigen
Dehydrogenase/reductase SDR family member 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NKAFWETPASMWDDINNVGLRGHYFCSVYGARLMV
PAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLA
ADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEE
VLQDPVLKQFKSAFSSAETTELSGKCVVALATDPN
ILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLS
SVLSHVSGLGWLASYLPSFLRVPKW
Storage
-20C
Provider Type Product Number
- No reagents -