HPA003323

TXNRD2 antibody from Atlas Antibodies
TR, TR3, TRXR2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003323
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003323, RRID:AB_1080396
Product name
Anti-TXNRD2
Provider product page
Atlas Antibodies - HPA003323
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
CAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEH
MASHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTTG
KEDTGTFDTVLWAIGRVPDTRSLNLEKAGVDTSPD
TQKILVDSREATSVPHIYAIGDVVEGRPELTPTAI
MAGRLLVQRLF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -