HPA009084

SIGLEC6 antibody from Sigma-Aldrich
CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009084
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009084, RRID:AB_1079967
Product name
Anti-Siglec-6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009084
Antibody type
Polyclonal
Antigen
Sialic acid-binding Ig-like lectin 6 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQ
TGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQE
PKVTDTEYSEIKIHK
Storage
-20C
Provider Type Product Number
- No reagents -