HPA018198

SIGLEC6 antibody from Atlas Antibodies
CD327, CD33L, CD33L1, OB-BP1, SIGLEC-6
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018198
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018198, RRID:AB_1856868
Product name
Anti-SIGLEC6
Provider product page
Atlas Antibodies - HPA018198
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQE
ETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFR
LKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLE
SGHPSNLTCSVPWVCEQGT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -