HPA009085

SIGLEC5 antibody from Atlas Antibodies
CD170, CD33L2, OB-BP2, SIGLEC-5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009085
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009085, RRID:AB_1079965
Product name
Anti-SIGLEC5
Provider product page
Atlas Antibodies - HPA009085
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPD
SAGDQASPPGDAPPLEEQKELHYASLSFSEMKSRE
PKDQEAPSTTEYSEIKTSK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -