HPA009085

SIGLEC5 antibody from Sigma-Aldrich
CD170, CD33L2, OB-BP2, SIGLEC-5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009085
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009085, RRID:AB_1079965
Product name
Anti-Siglec-5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009085
Antibody type
Polyclonal
Antigen
Sialic acid-binding Ig-like lectin 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KARRKQAAGRPEKMDDEDPIMGTITSGSRKKPWPD
SAGDQASPPGDAPPLEEQKELHYASLSFSEMKSRE
PKDQEAPSTTEYSEIKTSK
Storage
-20C
Provider Type Product Number
- No reagents -