H00026517-M03A

TIMM13 antibody from Abnova Corporation
Tim13, TIMM13B
No application information provided.

Antibody data

Product number
H00026517-M03A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00026517-M03A, RRID:AB_1205078
Product name
TIMM13 monoclonal antibody (M03A), clone 4F4
Provider product page
Abnova Corporation - H00026517-M03A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TIMM13.
Antigen sequence
MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANA
QELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCM
DRYMDAWNTVSRAYNSRLQRERANM
Isotype
IgM
Antibody clone number
4F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -