Antibody data

Product number
H00051378-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051378-M01, RRID:AB_1672252
Product name
ANGPT4 monoclonal antibody (M01), clone 1B7
Provider product page
Abnova Corporation - H00051378-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ANGPT4.
Antigen sequence
TRQEADRGCETLVVQHGHCSYTFLLPKSEPCPPGP
EVSRDSNTLQRESLANPLHLGKLPTQQVKQLEQAL
QNNTQWLKKLERAIKTI
Isotype
IgG
Antibody clone number
1B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -