PAB20505

TMEM59L antibody from Abnova Corporation
BSMAP, C19orf4

Antibody data

Product number
PAB20505
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20505, RRID:AB_10963716
Product name
TMEM59L polyclonal antibody
Provider product page
Abnova Corporation - PAB20505
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TMEM59L.
Antigen sequence
SLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGK
VVVFQTQPIVESLGFQGGRLQRVEVTWRGSHPEAL
EVHVDPVGPLDKVRKAKIRVKTSSKAKVESEEPQD
NDFLSCMSR
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -