HPA010661

TMEM59L antibody from Sigma-Aldrich
BSMAP, C19orf4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010661
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010661, RRID:AB_1078338
Product name
Anti-TMEM59L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010661
Antibody type
Polyclonal
Antigen
Transmembrane protein 59-like precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGK
VVVFQTQPIVESLGFQGGRLQRVEVTWRGSHPEAL
EVHVDPVGPLDKVRKAKIRVKTSSKAKVESEEPQD
NDFLSCMSR
Storage
-20C
Provider Type Product Number
- No reagents -