ABIN503386

DIRAS1 antibody from antibodies-online
Di-Ras1, GBTS1, RIG

Antibody data

Product number
ABIN503386
Provider
antibodies-online
Product name
anti-DIRAS Family, GTP-Binding RAS-Like 1 (DIRAS1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN503386
Antibody type
Polyclonal
Antigen
The immunogen for anti-DIRAS1 antibody: synthetic peptide directed towards the middle region of human DIRAS1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Zebrafish
Host
Rabbit
Antigen sequence
KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNI
DGKRS GKQKRTDRVK
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -