Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079974-B01P - Provider product page

- Provider
- Abnova Corporation
- Product name
- C7orf58 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human C7orf58 protein.
- Antigen sequence
MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTL
RGSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQ
CFLLSGNAQETRKVKESMETHFGSHGRRAILYRPP
FYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPG
LLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQL
GLHQKLRRREERQRPGSPASRRLSVR- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data