HPA012058

CPED1 antibody from Sigma-Aldrich
C7orf58, FLJ21986
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012058
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012058, RRID:AB_1845761
Product name
Anti-C7orf58 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012058
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf58 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQC
FLLSGNAQETRKVKESMETHFGSHGRRAILYRPPF
YSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGL
LEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLG
L
Storage
-20C
Provider Type Product Number
- No reagents -