HPA015627

BAIAP3 antibody from Sigma-Aldrich
BAP3, KIAA0734
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015627
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015627, RRID:AB_10603678
Product name
Anti-BAIAP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015627
Antibody type
Polyclonal
Antigen
BAI1-associated protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ATLFYTELLRKKVDTQPGAAGEAVSEALCVVLNNV
ELVRKAAGQALKGLAWPEGATGPEGVLPRPLLSCT
QALDDDLQREAHTVTAHLTSKMVGDIRKYVQHISL
SPDSIQNDEAVAPLMKYLDEKLALLNASLVKGNLS
Storage
-20C
Provider Type Product Number
- No reagents -