HPA011937

TFR2 antibody from Sigma-Aldrich
HFE3, TFRC2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011937
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011937, RRID:AB_1858243
Product name
Anti-TFR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011937
Antibody type
Polyclonal
Antigen
Transferrin receptor protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSPNHSGQTLYEQVVFTNPSWDAEVIRPLPMDSSA
YSFTAFVGVPAVEFSFMEDDQAYPFLHTKEDTYEN
LHKVLQGRLPAVAQAVAQLAGQLLIRLSHDRLLPL
DFGRYGDVVLRHIGNLNEFSGDLK
Storage
-20C
Provider Type Product Number
- No reagents -