H00054877-B01

ZCCHC2 antibody from Abnova Corporation
C18orf49, FLJ20222, FLJ20281, KIAA1744

Antibody data

Product number
H00054877-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054877-B01, RRID:AB_1139131
Product name
ZCCHC2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00054877-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZCCHC2 protein.
Antigen sequence
MPGGGGGPSAALREQERVYEWFGLVLGSAQRLEFM
CGLLDLCNPLELRFLGSCLEDLARKDYHYLRDSEA
KANGLSDPGPLADFREPAVRSRLIVYLALLGSENR
EAAGRLHRLLPQVDSVLKSLRAARGEGSRGGAEDE
RGEDGDGEQDAEKDGSGPEGGIVEPRVGGGLGSRA
QEELLLLFTMASLHPAFSFHQRVTLREHLERLRAA
LRGGPEDAEVEVEPCKFAGPRAQVRRTEPPWTRGA
IAAPAASPASLSDAPCPSPSPAQVARNPHPAAPSA
RGLSFVSLGRSVPLPHPTPHPGRHSHPPSQNALEV
PSVPRCCHGRRGAPRPGPLSEEKCRDVFGSEHLSA
RCGSRGALEEPV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -