WH0346606M5

MOGAT3 antibody from Sigma-Aldrich
DC7, DGAT2L2, MGAT3
ELISA
Recommended by provider

Antibody data

Product number
WH0346606M5
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0346606M5, RRID:AB_1842506
Product name
Monoclonal Anti-MOGAT3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0346606M5
Antibody type
Monoclonal
Antigen
MOGAT3 (NP_835470, a.a. 59-108) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYY
PVKLVKTAELPPDR* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -