H00346606-B01P

MOGAT3 antibody from Abnova Corporation
DC7, DGAT2L2, MGAT3

Antibody data

Product number
H00346606-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00346606-B01P, RRID:AB_11188912
Product name
MOGAT3 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00346606-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MOGAT3 protein.
Antigen sequence
MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLF
MGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTP
NQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPP
DRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPG
LRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLD
FILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQ
KRKGFVRLALRHGASLVPVYSFGENDIFRLKAFAT
GSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGL
LPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALY
MTALEQLFEEHKESCGVPASTCLTFI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -