H00346606-M05

MOGAT3 antibody from Abnova Corporation
DC7, DGAT2L2, MGAT3

Antibody data

Product number
H00346606-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00346606-M05, RRID:AB_534931
Product name
MOGAT3 monoclonal antibody (M05), clone 3F7
Provider product page
Abnova Corporation - H00346606-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MOGAT3.
Antigen sequence
YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYY
PVKLVKTAELPPDR
Isotype
IgG
Antibody clone number
3F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -