HPA011940

MOGAT3 antibody from Atlas Antibodies
DC7, DGAT2L2, MGAT3
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011940
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011940, RRID:AB_1854057
Product name
Anti-MOGAT3
Provider product page
Atlas Antibodies - HPA011940
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLM
GFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPI
PVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESC
GVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -