Antibody data

Product number
HPA063358
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA063358, RRID:AB_2684995
Product name
Anti-ZNF554
Provider product page
Atlas Antibodies - HPA063358
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GNHLCGSELDITSLASDSVLNHHQLGYADRRPCES
NECGNAIRQNSHFIQHGGKMFVYLENGQSLNHGMA
LTIHNKINTAEKP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -