AV36167

ZNF554 antibody from Sigma-Aldrich
FLJ34817
No application information provided.

Antibody data

Product number
AV36167
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV36167, RRID:AB_1859336
Product name
Anti-ZNF554 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV36167
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF554 with an internal ID of P07495
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTPQASCSDWMTVLRNQDSTYKKVALQEEPASGIN
MIKLIREDGGWKQLE
Storage
-20C
Provider Type Product Number
- No reagents -