AV36167

ZNF554 antibody from MilliporeSigma / Merck KGaA
FLJ34817
No application information provided.

Antibody data

Product number
AV36167
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF554 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV36167
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF554 with an internal ID of P07495
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTPQASCSDWMTVLRNQDSTYKKVALQEEPASGIN
MIKLIREDGGWKQLE
Storage
-20C