HPA020200

PHLPP1 antibody from Atlas Antibodies
KIAA0606, PHLPP, PLEKHE1, PPM3A, SCOP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020200
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020200, RRID:AB_2670383
Product name
Anti-PHLPP1
Provider product page
Atlas Antibodies - HPA020200
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVH
VFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHK
GGGVVKVLGQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -