Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00253260-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00253260-M01, RRID:AB_509256
- Product name
- RICTOR monoclonal antibody (M01), clone 1F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RICTOR.
- Antigen sequence
MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPS
DNLREILQNVARLQGVSNMRKLGHLNNFTKLLCDI
GHSEEKLGFHYEDIIICLRLALLNEAKE- Isotype
- IgG
- Antibody clone number
- 1F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references GNAQ and BRAF mutations show differential activation of the mTOR pathway in human transformed cells.
mTOR pathway overactivation in BRAF mutated papillary thyroid carcinoma.
Nuclear forkhead box O1 controls and integrates key signaling pathways in hepatocytes.
Pópulo H, Tavares S, Faustino A, Nunes JB, Lopes JM, Soares P
PeerJ 2013;1:e104
PeerJ 2013;1:e104
mTOR pathway overactivation in BRAF mutated papillary thyroid carcinoma.
Faustino A, Couto JP, Pópulo H, Rocha AS, Pardal F, Cameselle-Teijeiro JM, Lopes JM, Sobrinho-Simões M, Soares P
The Journal of clinical endocrinology and metabolism 2012 Jul;97(7):E1139-49
The Journal of clinical endocrinology and metabolism 2012 Jul;97(7):E1139-49
Nuclear forkhead box O1 controls and integrates key signaling pathways in hepatocytes.
Naïmi M, Gautier N, Chaussade C, Valverde AM, Accili D, Van Obberghen E
Endocrinology 2007 May;148(5):2424-34
Endocrinology 2007 May;148(5):2424-34
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- RICTOR monoclonal antibody (M01), clone 1F3 Western Blot analysis of RICTOR expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RICTOR expression in transfected 293T cell line by RICTOR monoclonal antibody (M01), clone 1F3.Lane 1: RICTOR transfected lysate(29.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RICTOR is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of RICTOR transfected lysate using anti-RICTOR monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RICTOR MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to RICTOR on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol