Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00056913-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00056913-M01, RRID:AB_518691
- Product name
- C1GALT1 monoclonal antibody (M01), clone 1F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant C1GALT1.
- Antigen sequence
ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGP
GCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLY
RYQPTLPERILKEISQANKNEDTKVKLGNP- Isotype
- IgG
- Antibody clone number
- 1F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Association of cell surface mucins with galectin-3 contributes to the ocular surface epithelial barrier.
Argüeso P, Guzman-Aranguez A, Mantelli F, Cao Z, Ricciuto J, Panjwani N
The Journal of biological chemistry 2009 Aug 21;284(34):23037-45
The Journal of biological chemistry 2009 Aug 21;284(34):23037-45
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- C1GALT1 monoclonal antibody (M01), clone 1F1 Western Blot analysis of C1GALT1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged C1GALT1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol