HPA012819

C1GALT1 antibody from Sigma-Aldrich
C1GALT, T-synthase
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012819
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012819, RRID:AB_1845624
Product name
Anti-C1GALT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012819
Antibody type
Polyclonal
Antigen
Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKE
ALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVE
AGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWN
YNYYPPVEGPGCCSDLAVSFHYVDS
Storage
-20C
Provider Type Product Number
- No reagents -