Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051056-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051056-A01, RRID:AB_489359
- Product name
- LAP3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant LAP3.
- Antigen sequence
EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIG
KYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNK
DEVPYLRKGMTGRPTRTLIEFLLRFSQDNA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cytosolic aminopeptidases influence MHC class I-mediated antigen presentation in an allele-dependent manner.
Kim E, Kwak H, Ahn K
Journal of immunology (Baltimore, Md. : 1950) 2009 Dec 1;183(11):7379-87
Journal of immunology (Baltimore, Md. : 1950) 2009 Dec 1;183(11):7379-87
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LAP3 polyclonal antibody (A01), Lot # FHC4060725QCS1 Western Blot analysis of LAP3 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of LAP3 expression in transfected 293T cell line by LAP3 polyclonal antibody (A01).Lane1:LAP3 transfected lysate(56.166 KDa).Lane2:Non-transfected lysate.