Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00144568-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00144568-B01P, RRID:AB_1572618
- Product name
- A2ML1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human A2ML1 protein.
- Antigen sequence
MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSV
EIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAI
VEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTL
NIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVY
DYYLPDEQATIQYSDPCE- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Laboratory diagnosis of paraneoplastic pemphigus.
The protease inhibitor alpha-2-macroglobulin-like-1 is the p170 antigen recognized by paraneoplastic pemphigus autoantibodies in human.
Poot AM, Diercks GF, Kramer D, Schepens I, Klunder G, Hashimoto T, Borradori L, Jonkman MF, Pas HH
The British journal of dermatology 2013 Nov;169(5):1016-24
The British journal of dermatology 2013 Nov;169(5):1016-24
The protease inhibitor alpha-2-macroglobulin-like-1 is the p170 antigen recognized by paraneoplastic pemphigus autoantibodies in human.
Schepens I, Jaunin F, Begre N, Läderach U, Marcus K, Hashimoto T, Favre B, Borradori L
PloS one 2010 Aug 18;5(8):e12250
PloS one 2010 Aug 18;5(8):e12250
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of A2ML1 expression in transfected 293T cell line (H00144568-T01) by A2ML1 MaxPab polyclonal antibody.Lane1:A2ML1 transfected lysate(17.38 KDa).Lane2:Non-transfected lysate.