H00144568-B01P

A2ML1 antibody from Abnova Corporation
CPAMD9, FLJ25179, p170

Antibody data

Product number
H00144568-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00144568-B01P, RRID:AB_1572618
Product name
A2ML1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00144568-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human A2ML1 protein.
Antigen sequence
MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSV
EIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAI
VEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTL
NIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVY
DYYLPDEQATIQYSDPCE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -