HPA029203

NUBPL antibody from Atlas Antibodies
C14orf127, FLJ12660, huInd1, IND1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029203
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029203, RRID:AB_10545921
Product name
Anti-NUBPL
Provider product page
Atlas Antibodies - HPA029203
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSRGLPKQKPIEGVKQVIVVASGKGGVGKSTTAVN
LALALAANDSSKAIGLLDVDVYGPSVPKMMNLKGN
PELSQSNLMRPLLNYGIACMSMGFLVEESEPVVWR
G
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -