HPA001271

AIFM3 antibody from Sigma-Aldrich
AIFL, FLJ30473
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001271
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001271, RRID:AB_1078114
Product name
Anti-AIFM3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001271
Antibody type
Polyclonal
Antigen
Apoptosis-inducing factor 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGD
LEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQR
RTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAE
TLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQP
E
Storage
-20C
Provider Type Product Number
- No reagents -