Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010232-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010232-M02, RRID:AB_733214
- Product name
- MSLN monoclonal antibody (M02), clone 1A10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MSLN.
- Antigen sequence
DLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQS
FLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLP
LTVAEVQKLLGPHVEGLKAEERHRPVRDWI- Isotype
- IgG
- Antibody clone number
- 1A10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged MSLN is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of MSLN transfected lysate using anti-MSLN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MSLN MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol