Antibody data

Product number
ABIN502253
Provider
antibodies-online
Product name
anti-Mesothelin (MSLN) (Middle Region) antibody
Provider product page
antibodies-online - ABIN502253
Antibody type
Polyclonal
Antigen
The immunogen for anti-MSLN antibody: synthetic peptide directed towards the middle region of human MSLN
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
LKALLEVNKGHEMSPQAPRRPLPQVATLIDRFVKG
RGQLD KDTLDTLTAF
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -