HPA017172

MSLN antibody from Sigma-Aldrich
CAK1, MPF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017172
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017172, RRID:AB_1853819
Product name
Anti-MSLN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017172
Antibody type
Polyclonal
Antigen
Mesothelin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQRSSRDPSWRQPERTILRPRFRREVEKTACPSGK
KAREIDESLIFYKKWELEACVDAALLATQMDRVNA
IPFTYEQLDVLKHKLDELYPQGYPESVIQH
Storage
-20C
Provider Type Product Number
- No reagents -