Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064151-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064151-M01, RRID:AB_489734
- Product name
- HCAP-G monoclonal antibody (M01), clone 4B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HCAP-G.
- Antigen sequence
TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTN
RGQRKVTVSARTNRRCQTAEADSESDHEVPEPESE
MKMRLPRRAKTAALEKSKLNLAQFLNEDLS- Isotype
- IgG
- Antibody clone number
- 4B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Combined functional genome survey of therapeutic targets for hepatocellular carcinoma.
Satow R, Shitashige M, Kanai Y, Takeshita F, Ojima H, Jigami T, Honda K, Kosuge T, Ochiya T, Hirohashi S, Yamada T
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 May 1;16(9):2518-28
Clinical cancer research : an official journal of the American Association for Cancer Research 2010 May 1;16(9):2518-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HCAP-G monoclonal antibody (M01), clone 4B1 Western Blot analysis of HCAP-G expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HCAP-G is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HCAP-G on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol