Antibody data

Product number
H00001723-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001723-M01, RRID:AB_490083
Product name
DHODH monoclonal antibody (M01), clone 6E1
Provider product page
Abnova Corporation - H00001723-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DHODH.
Antigen sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGL
LPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHG
EAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRL
PEDQ
Isotype
IgG
Antibody clone number
6E1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -