Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001723-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001723-M01, RRID:AB_490083
- Product name
- DHODH monoclonal antibody (M01), clone 6E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DHODH.
- Antigen sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGL
LPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHG
EAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRL
PEDQ- Isotype
- IgG
- Antibody clone number
- 6E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inhibition of pyrimidine biosynthesis pathway suppresses viral growth through innate immunity.
Lucas-Hourani M, Dauzonne D, Jorda P, Cousin G, Lupan A, Helynck O, Caignard G, Janvier G, André-Leroux G, Khiar S, Escriou N, Desprès P, Jacob Y, Munier-Lehmann H, Tangy F, Vidalain PO
PLoS pathogens 2013;9(10):e1003678
PLoS pathogens 2013;9(10):e1003678
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DHODH monoclonal antibody (M01), clone 6E1 Western Blot analysis of DHODH expression in MCF-7 ( Cat # L046V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DHODH is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to DHODH on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol