HPA010123

DHODH antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010123
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010123, RRID:AB_1847648
Product name
Anti-DHODH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010123
Antibody type
Polyclonal
Antigen
Dihydroorotate dehydrogenase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QERDALRRVHRPAVLVKIAPDLTSQDKEDIASVVK
ELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKP
LRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDAL
EKIRAG
Storage
-20C
Provider Type Product Number
- No reagents -