HPA057697

CHST14 antibody from Atlas Antibodies
D4ST-1, D4ST1, HD4ST

Antibody data

Product number
HPA057697
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA057697, RRID:AB_2683505
Product name
Anti-CHST14
Provider product page
Atlas Antibodies - HPA057697
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGD
DVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAV
HY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -