AV48994

CHST14 antibody from Sigma-Aldrich
D4ST-1, D4ST1, HD4ST
No application information provided.

Antibody data

Product number
AV48994
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV48994, RRID:AB_1847459
Product name
Anti-CHST14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV48994
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human CHST14 with an internal ID of Y02145
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAG
PSPAGDDVTFPEFLR
Storage
-20C
Provider Type Product Number
- No reagents -