Antibody data

Product number
R32192
Provider
NSJ Bioreagents
Product name
ZP2 Antibody
Provider product page
NSJ Bioreagents - R32192
Antibody type
Polyclonal
Antigen
Amino acids ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD of human ZP2 were used as the immunogen for the ZP2 antibody.
Description
Antigen affinity
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the ZP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -