R32192
ZP2 antibody from NSJ Bioreagents
ZPA
- Western blot
Supportive data in Antibodypedia
- Immunohistochemistry
Supportive data in Antibodypedia
Antibody data
- Antibody Data
- Knockdown Reagents [0]
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32192
- Provider
- NSJ Bioreagents
- Product name
- ZP2 Antibody
- Provider product page
- NSJ Bioreagents - R32192
- Antibody type
- Polyclonal
- Antigen
- Amino acids ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD of human ZP2 were used as the immunogen for the ZP2 antibody.
- Description
- Antigen affinity
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the ZP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider | Type | Product Number |
---|---|---|
- No reagents - | ||