Antibody data

Product number
H00007783-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007783-M01, RRID:AB_1717369
Product name
ZP2 monoclonal antibody (M01), clone 2B9
Provider product page
Abnova Corporation - H00007783-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZP2.
Antigen sequence
NSSCQPVFEAQSQGLVRFHIPLNGCGTRYKFEDDK
VVYENEIHALWTDFPPSKISRDSEFRMTVKCSYSR
NDMLLNINVESLTPPVASVKLGPFTLILQSYPDNS
YQQPY
Isotype
IgG
Antibody clone number
2B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -