AV45470

ZP2 antibody from Sigma-Aldrich
ZPA
No application information provided.

Antibody data

Product number
AV45470
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV45470, RRID:AB_1859484
Product name
Anti-ZP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV45470
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZP2 with an internal ID of P26535
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
TFHPVGSSVTHPDHYQRFDMKAFAFVSEAHVLSSL
VYFHCSALICNRLSP
Storage
-20C
Provider Type Product Number
- No reagents -