HPA026624

KNL1 antibody from Sigma-Aldrich
AF15Q14, CASC5, CT29, D40, hKNL-1, hSpc105, KIAA1570, MCPH4, PPP1R55, Spc7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026624
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026624, RRID:AB_10601696
Product name
Anti-CASC5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026624
Antibody type
Polyclonal
Antigen
cancer susceptibility candidate 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HHTEEDIDKSANSVLIKNLSRTPSSCSSSLDSIKA
DGTSLDFSTYRSSQMESQFLRDTICEESLREKLQD
GRITIREFFILLQVHILIQKPRQSNLPGNFTVNTP
PTPEDLMLSQYVYRPKIQIYREDCEARRQKIEELK
LSASNQDKL
Storage
-20C
Provider Type Product Number
- No reagents -