HPA017430

FIS1 antibody from Sigma-Aldrich
CGI-135, Fis1, H_NH0132A01.6, TTC11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017430
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017430, RRID:AB_1848608
Product name
Anti-FIS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017430
Antibody type
Polyclonal
Antigen
Mitochondrial fission 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQ
FEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ
RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNN
QAKELERLIDKAMKKD
Storage
-20C
Provider Type Product Number
- No reagents -