H00055756-B01

INTS9 antibody from Abnova Corporation
CPSF2L, FLJ10871, RC-74

Antibody data

Product number
H00055756-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055756-B01, RRID:AB_1204904
Product name
RC74 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055756-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human RC74 protein.
Antigen sequence
MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTST
LNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKE
CSGHVFVDSVPEFCLPETELIDLSTVDVILISNYH
CMMALPYITEHTGFTGTVYATEPTVQIGRLLMEEL
VNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEV
STWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQ
VTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTT
HPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGE
FCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQY
IDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHN
KQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSN
DFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTV
IFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFI
QVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMI
DCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADS
LVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPA
QPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFV
QTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEE
DSTHIICDNDEMLRVRLRDLVLKFLQKF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -