Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311509 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Egl Nine Homolog 3 (C. Elegans) (EGLN3) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-EGLN3 antibody: synthetic peptide directed towards the C terminal of human EGLN3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAK
KKFRN LTRKTESALT- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references PHDs overactivation during chronic hypoxia "desensitizes" HIFalpha and protects cells from necrosis.
Ginouvès A, Ilc K, Macías N, Pouysségur J, Berra E
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 25;105(12):4745-50
Proceedings of the National Academy of Sciences of the United States of America 2008 Mar 25;105(12):4745-50
No comments: Submit comment
No validations: Submit validation data