HPA027422

HASPIN antibody from Atlas Antibodies
GSG2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027422
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027422, RRID:AB_10601812
Product name
Anti-GSG2
Provider product page
Atlas Antibodies - HPA027422
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGD
YQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDK
MLKQMTFKTKCNTPAMK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -