HPA027422

HASPIN antibody from Sigma-Aldrich
GSG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027422
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027422, RRID:AB_10601812
Product name
Anti-GSG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027422
Antibody type
Polyclonal
Antigen
germ cell associated 2 (haspin) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGD
YQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDK
MLKQMTFKTKCNTPAMK
Storage
-20C
Provider Type Product Number
- No reagents -