HPA011944

COA1 antibody from Sigma-Aldrich
C7orf44, FLJ10803, MITRAC15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011944
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011944, RRID:AB_1848671
Product name
Anti-C7orf44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011944
Antibody type
Polyclonal
Antigen
Uncharacterized protein C7orf44 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKL
IDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGG
PFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK
Storage
-20C
Provider Type Product Number
- No reagents -