H00011340-M02

EXOSC8 antibody from Abnova Corporation
bA421P11.3, CIP3, EAP2, OIP2, p9, RRP43, Rrp43p

Antibody data

Product number
H00011340-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00011340-M02, RRID:AB_1574780
Product name
EXOSC8 monoclonal antibody (M02), clone 4B3
Provider product page
Abnova Corporation - H00011340-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EXOSC8.
Antigen sequence
AEVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPT
GEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGA
KLQDCMSRAVTRHKEVKKLMDEVIKSMKPK
Isotype
IgG
Antibody clone number
4B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -