Antibody data

Product number
H00058533-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00058533-M01, RRID:AB_1137046
Product name
SNX6 monoclonal antibody (M01), clone 3B11
Provider product page
Abnova Corporation - H00058533-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SNX6.
Antigen sequence
MTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRV
AAHPILGRDLNFHVFLEYNQDLSVRGKNKKEKLED
FFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYH
NRVKDASAKSDRMTRSHKSAADDYNRIGSSLYALG
TQDSTDICKFFLKVSELFDKTRKIEARVSADEDLK
LSDLLKYYLRESQAAKDLLYRRSRSLVDYENANKA
LDKARAKNKDVLQAETSQQLCCQKFEKISESAKQE
LIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQ
NCLAVLNGDT
Isotype
IgG
Antibody clone number
3B11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -